missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human AZIN1 (aa 124-209) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP93830
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82991 (PA5-82991. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Antizyme inhibitor (AZIN1) protein that positively regulates ornithine decarboxylase (ODC) activity and polyamine uptake. AZI is an enzymatically inactive ODC homolog that counteracts the negative effect of ODC antizymes (AZs) OAZ1, OAZ2 and OAZ3 on ODC activity by competing with ODC for antizyme-binding. Inhibits antizyme-dependent ODC degradation and releases ODC monomers from their inactive complex with antizymes, leading to formation of the catalytically active ODC homodimer and restoring polyamine production.Spécifications
| O14977 | |
| Blocking Assay, Control | |
| 51582 | |
| 100 μL | |
| 1700085L02Rik; antizyme inhibitor 1; AZI; AZIA1; AZIN1; O OAZIN; OAZI; Oazin; ODC antizyme inhibitor; ODC1L; Ornithine decarboxylase antizyme inhibitor | |
| AZIN1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human AZIN1 (aa 124-209) Control Fragment | |
| RUO | |
| AZIN1 | |
| Unconjugated | |
| Recombinant | |
| AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |