missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human APOOL (aa 145-260) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91962
Description
Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51427 (PA5-51427. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein which contains an apolipoprotein O superfamily domain. This domain is found on proteins in circulating lipoprotein complexes. [provided by RefSeq, Sep 2011].Spécifications
| Q6UXV4 | |
| Blocking Assay, Control | |
| 139322 | |
| 100 μL | |
| 6720473G16Rik; 9430083G14Rik; AAIR8193; apolipoprotein O like; apolipoprotein O-like; Apool; CXorf33; E130106L15Rik; FAM121A; family with sequence similarity 121 A; MIC27; MICOS complex subunit MIC27; Protein FAM121A; RGD1549725; UNQ8193; UNQ8193/PRO23204 | |
| APOOL | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human APOOL (aa 145-260) Control Fragment | |
| RUO | |
| APOOL | |
| Unconjugated | |
| Recombinant | |
| ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |