missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human APBB3 (aa 310-394) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109542
Description
Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the APBB protein family. It is found in the cytoplasm and binds to the intracellular domain of the Alzheimer's disease beta-amyloid precursor protein (APP) as well as to other APP-like proteins. It is thought that the protein encoded by this gene may modulate the internalization of APP. Multiple transcript variants encoding several different isoforms have been found for this gene.Spécifications
| O95704 | |
| Blocking Assay, Control | |
| 10307 | |
| 100 μL | |
| amyloid beta (A4) precursor protein-binding, family B, member 3; amyloid beta A4 precursor protein-binding family B member 3; amyloid beta precursor protein binding family B member 3; amyloid precursor interacting protein; Amyloid-beta A4 precursor protein-binding family B member 3; APBB3; Fe65L2; fe65-like protein 2; Protein Fe65-like 2; Rirl2; SRA; TR2S | |
| APBB3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human APBB3 (aa 310-394) Control Fragment | |
| RUO | |
| APBB3 | |
| Unconjugated | |
| Recombinant | |
| LNEAIGTLTARGDRNAWVPTMLSVSDSLMTAHPIQAEASTEEEPLWQCPVRLVTFIGVGRDPHTFGLIADLGRQSFQCAAFWCQP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |