missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Afadin (aa 245-325) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94824
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
AFDN belongs to an adhesion system, probably together with the E-cadherin-catenin system, which plays a role in the organization of homotypic, interneuronal and heterotypic cell-cell adherens junctions (AJs). Nectin- and actin-filament-binding protein that connects nectin to the actin cytoskeleton.Spécifications
| P55196 | |
| Blocking Assay, Control | |
| 4301 | |
| 100 μL | |
| 5033403D15Rik; Af6; Af-6; Afadin; Afadin adherens junction formation factor; afadin, adherens junction formation factor; afadin; afadin, adherens junction formation factor; AFDN; ALL1-fused gene from chromosome 6 protein; FLJ34371; Gm314; I-afadin; MLL-AF6; MLLT4; myeloid/lymphoid or mixed lineage-leukemia translocation to 4 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 4; myeloid/lymphoid or mixed-lineage leukemia 4; myeloid/lymphoid or mixed-lineage leukemia; translocated to, 4; protein Af-6; RP3-431P23.3; RP3-470B24.4; S-afadin | |
| Afdn | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Afadin (aa 245-325) Control Fragment | |
| RUO | |
| Afadin | |
| Unconjugated | |
| Recombinant | |
| DSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIARVMLPPGAQHSDEKGAKEIILDDDECP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |