missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Adiponectin Receptor 2 (aa 11-79) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100447
Description
Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60488 (PA5-60488. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Adiponectin (also known as 30-kDa adipocyte complement-related protein; Acrp30) is a hormone secreted by adipocytes that acts as an antidiabetic and anti-atherogenic adipokine. Levels of adiponectin in the blood are decreased under conditions of obesity, insulin resistance and type 2 diabetes. Administration of adiponectin causes glucose-lowering effects and ameliorates insulin resistance in mice. Conversely, adiponectin-deficient mice exhibit insulin resistance and diabetes. This insulin-sensitizing effect of adiponectin seems to be mediated by an increase in fatty-acid oxidation through activation of AMP kinase and PPAR. Here we report the cloning of complementary DNAs encoding adiponectin receptors 1 and 2 (AdipoR1 and AdipoR2) by expression cloning. AdipoR1 is abundantly expressed in skeletal muscle, whereas AdipoR2 is predominantly expressed in the liver. These two adiponectin receptors are predicted to contain seven transmembrane domains, but are structurally and functionally distinct from G-protein-coupled receptors. Expression of AdipoR1/R2 or suppression of AdipoR1/R2 expression by small-interfering RNA supports our conclusion that they serve as receptors for globular and full-length adiponectin, and that they mediate increased AMP kinase and PPAR- ligand activities, as well as fatty-acid oxidation and glucose uptake by adiponectin.Spécifications
| Q86V24 | |
| Blocking Assay, Control | |
| 79602 | |
| 100 μL | |
| 1110001I14Rik; ACDCR2; ADCR2; adiponectin receptor 2; adiponectin receptor protein 2; Adipor2; AI115388; AW554121; D6Ucla1e; FLJ21432; MGC4640; Paqr2; Parq2; Progestin and adipoQ receptor family member 2; Progestin and adipoQ receptor family member II | |
| ADIPOR2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Adiponectin Receptor 2 (aa 11-79) Control Fragment | |
| RUO | |
| Adiponectin Receptor 2 | |
| Unconjugated | |
| Recombinant | |
| CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |