tetratricopeptide repeat domain 1, Mouse, Clone: 4E3, Abnova™

Mouse monoclonal antibody raised against a partial recombinant TTC1.

Supplier: Abnova Corporation H00007265M01

Numéro de catalogue. 89-001-033

Quantité

Description

Sequence: LRRAELYEKTDKLDEALEDYKSILEKDPSIHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPFGLSTENFQIKQDSSTGSYSINFVQNPNNNR

Spécifications

Antigen	tetratricopeptide repeat domain 1
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_003314
Gene Symbols	TTC1
Immunogen	TTC1 (NP_003305, 193 a.a. ∼ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Whole Molecule	Yes
Gene ID (Entrez)	7265
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG2b κ

Applications	ELISA, Immunohistochemistry (PFA fixed), Western Blot
Clone	4E3
Description	Mouse monoclonal antibody raised against a partial recombinant TTC1.
Gene	TTC1
Gene Alias	FLJ46404/TPR1
Host Species	Mouse
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody

missing translation for 'recommendations'

Description