HD, Mouse, Clone: 2E10, Abnova™

Mouse monoclonal antibody raised against a partial recombinant HD.

Supplier: Abnova Corporation H00003064M01

Numéro de catalogue. 89-022-457

Quantité

Description

Sequence: AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW

Spécifications

Antigen	HD
Classification	Monoclonal
Conjugate	Unconjugated
Formulation	PBS with no preservative; pH 7.4
Gene Accession No.	NM_002111
Gene Symbols	HTT
Immunogen	HD (NP_002102, 81 a.a. ∼ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Human
Product Type	Antibody
Isotype	IgG1 κ

Applications	ELISA, Immunofluorescence, Western Blot
Clone	2E10
Description	Mouse monoclonal antibody raised against a partial recombinant HD.
Gene	HTT
Gene Alias	HD/IT15
Host Species	Mouse
Purification Method	Affinity chromatography
Regulatory Status	RUO
Gene ID (Entrez)	3064
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form	Liquid

missing translation for 'recommendations'

Description