missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TM2D1 (aa 48-118) Control Fragment Recombinant Protein

Catalog No. RP95667
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95667 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95667 Supplier Invitrogen™ Supplier No. RP95667

Please call Customer Service at 1-800-234-7437 or send an email to help@thermofisher.com for assistance.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61139. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Proteolytic cleavage of the Amyloid protein precursor (APP) gives rise to the β-Amyloid and Amyloid A4 proteins, which are present in human platelets. Amyloid deposition is associated with type II diabetes, Down syndrome and a variety of neurological disorders, including Alzheimer's disease. Proteolytic cleavage of APP leads to the formation of the Amyloid β/A4 Amyloid protein. This protein is involved in the formation of neurofibrillary tangles and plaques that characterize the senile plaques of Alzheimer's patients. BBP (Beta-amyloid-binding protein), also known as TM2D1 (TM2 domain-containing protein 1), is a 207 amino acid multi-pass membrane protein containing a G protein-coupling module that allows for interaction with the β-amyloid peptide of APP. In cell culture, expression of BBP induces caspase-dependent vulnerability to β-amyloid peptide toxicity, suggesting that it is a target of β-amyloid and may be involved in the molecular pathophysiology of Alzheimer's disease.

Specifications

Accession Number Q9BX74
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 83941
Name Human TM2D1 (aa 48-118) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2310026L18Rik; AA990549; Amyloid-beta-binding protein; Bbp; beta-amyloid binding protein; beta-amyloid-binding protein; hBBP; mBBP; TM2 domain containing 1; TM2 domain-containing protein 1; Tm2d1
Common Name TM2D1
Gene Symbol TM2D1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less