accessibility menu, dialog, popup

UserName

Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Form 
  • (1)
  • (1)
  • (23,208)
  • (4,938)
  • (29)
  • (22)
  • (26)
  • (35)
For Use With (Application) 
  • (2)
  • (79)
  • (3)
  • (1)
  • (1)
  • (1)
  • (3)
  • (21,577)
  • (1)
  • (1)
  • (2)
  • (6)
  • (44)
  • (2)
  • (2)
  • (2)
  • (2)
  • (1)
  • (2)
  • (3)
  • (1)
  • (1)
  • (3)
  • (5)
  • (10)
  • (22,172)
  • (1)
  • (2)
  • (1)
  • (1)
  • (2,268)
  • (1)
  • (8)
  • (2)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1)
  • (8)
  • (4,655)
  • (134)
  • (1)
  • (1)
  • (4)
  • (1)
  • (20)
  • (3)
  • (257)
  • (32)
  • (5)
  • (2)
  • (13)
  • (1)
  • (1,226)
  • (2)
  • (19)
  • (26)
  • (1)
  • (2)
  • (1)
  • (18)
  • (2)
  • (3)
  • (4)
  • (1)
  • (7)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (64)
  • (3)
  • (6)
  • (1)
  • (1)
  • (6)
  • (7)
  • (5)
  • (1)
  • (1)
  • (7)
  • (6)
  • (3)
  • (14)
  • (2)
  • (4)
  • (5)
  • (6)
  • (1)
  • (2,246)
  • (1)
  • (1)
Recombinant 
  • (62)
  • (28,136)
Conjugate 
  • (11)
  • (1)
  • (4)
  • (2)
  • (9)
  • (7)
  • (1)
  • (7)
  • (1)
  • (3)
  • (1)
  • (1)
  • (2)
  • (1)
  • (4)
  • (8)
  • (2)
  • (1)
  • (12)
  • (5)
  • (2)
  • (3)
  • (27,852)
Species 
  • (1)
  • (9)
  • (23)
  • (2)
  • (1)
  • (280)
  • (23,126)
  • (2)
  • (101)
  • (1)
  • (1)
  • (1)
  • (4)
  • (8)
  • (3)
  • (179)
  • (15)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (1)

brands

  • (327)
  • (3)
  • (20,921)
  • (6)
  • (286)
  • (467)
  • (81)
  • (2)
  • (265)
  • (432)
  • (3)
  • (1)
  • (2)
  • (6,619)
  • (1)

special interests

  • (2)

Form

  • (1)
  • (1)
  • (23,208)
  • (4,938)
  • (29)
  • (22)
  • (26)
  • (35)

For Use With (Application)

  • (2)
  • (79)
  • (3)
  • (1)
  • (1)
  • (1)
  • (3)
  • (21,577)
  • (1)
  • (1)
  • (2)
  • (6)
  • (44)
  • (2)
  • (2)
  • (2)
  • (2)
  • (1)
  • (2)
  • (3)
  • (1)
  • (1)
  • (3)
  • (5)
  • (10)
  • (22,172)
  • (1)
  • (2)
  • (1)
  • (1)
  • (2,268)
  • (1)
  • (8)
  • (2)
  • (1)
  • (8)
  • (1)
  • (1)
  • (1)
  • (8)
  • (4,655)
  • (134)
  • (1)
  • (1)
  • (4)
  • (1)
  • (20)
  • (3)
  • (257)
  • (32)
  • (5)
  • (2)
  • (13)
  • (1)
  • (1,226)
  • (2)
  • (19)
  • (26)
  • (1)
  • (2)
  • (1)
  • (18)
  • (2)
  • (3)
  • (4)
  • (1)
  • (7)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (64)
  • (3)
  • (6)
  • (1)
  • (1)
  • (6)
  • (7)
  • (5)
  • (1)
  • (1)
  • (7)
  • (6)
  • (3)
  • (14)
  • (2)
  • (4)
  • (5)
  • (6)
  • (1)
  • (2,246)
  • (1)
  • (1)

Recombinant

  • (62)
  • (28,136)

Conjugate

  • (11)
  • (1)
  • (4)
  • (2)
  • (9)
  • (7)
  • (1)
  • (7)
  • (1)
  • (3)
  • (1)
  • (1)
  • (2)
  • (1)
  • (4)
  • (8)
  • (2)
  • (1)
  • (12)
  • (5)
  • (2)
  • (3)
  • (27,852)

Species

  • (1)
  • (9)
  • (23)
  • (2)
  • (1)
  • (280)
  • (23,126)
  • (2)
  • (101)
  • (1)
  • (1)
  • (1)
  • (4)
  • (8)
  • (3)
  • (179)
  • (15)

Immunoassay Kit Format

  • (10)

Target Species

  • (2)
  • (3)
  • (5)

Detection Method

  • (1)

Substrate Properties

  • (1)

Substrate Type

  • (1)
1 – 15 of 24,448 results
1

MilliporeSigma™ Casein, Bovine Milk, Protein

Regulatory Status RUO
Preparation Method Dilute alkaline solutions (1mg/mL)
Form Solid
Immunogen Casein
Storage Requirements Following reconstitution, aliquot and freeze (−20°C). Stock solutions are stable for up to 3 months at −20°C.
Species Bovine
Recombinant Native
5

Invitrogen™ Human SLC7A5 (aa 16-50) Control Fragment Recombinant Protein

Recombinant Protein

Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human SLC7A5 (aa 16-50) Control Fragment
Recombinant Recombinant
6

Invitrogen™ Human LIS1 (aa 16-161) Control Fragment Recombinant Protein

Recombinant Protein

Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence ADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGLLEKKWTSVIRLQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHS
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human LIS1 (aa 16-161) Control Fragment
Recombinant Recombinant
10

MilliporeSigma™ Casein, Bovine Milk, Carbohydrate and Fatty Acid Free, Protein

Regulatory Status RUO
Purification Method Assay
Preparation Method Dilute Alkaline Solutions (10mg/mL)
Purity or Quality Grade ≥95%
Form Solid
Without Additives Carbohydrate and Fatty Acid Free
Immunogen Casein
Storage Requirements Following reconstitution, store in the refrigerator (4°C). Stock solutions are stable for up to 1 week at 4°C. After one week, it is recommended that fresh solution be prepared.
Species Bovine
Recombinant Native
12

Invitrogen™ Human IL-34 (Carrier-Free) Recombinant Protein, eBioscience™

Recombinant Protein

Purity or Quality Grade Affinity chromatography
Conjugate Unconjugated
Specific Reactivity Human
Form Lyophilized
pH Range 3.0
Common Name Human IL-34 Carrier-Free
Molecular Weight (g/mol) 52.5kDa
Gene Symbol IL34
Endotoxin Concentration Less than 0.1ng/μg cytokine as determined by the LAL assay
Storage Requirements -20°C
Protein Subtype Recombinant
Name Human IL-34 Carrier-Free
Accession Number Q6ZMJ4
Regulatory Status RUO
Purification Method SDS-PAGE and HPLC
Product Type Recombinant Protein, Carrier-Free
Biological Activity The activity of this protein was determined by measuring MCP-1 secretion from normal human peripheral blood cells.
Gene ID (Entrez) 146433
Formulation 0.02M citric acid with no preservative; pH 3.0
Structural Form HEK 293 cells (amino acids Asn21-Pro242; Accession # NP_001166243); contains a C-terminal 8X His tag
Shelf Life 12 Months
Cross Reactivity Hu
Species Human (HEK293)
Recombinant Recombinant
13

Invitrogen™ Human PPAP2C (aa 252-287) Control Fragment Recombinant Protein

Recombinant Protein

Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence PQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSS
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human PPAP2C (aa 252-287) Control Fragment
Recombinant Recombinant
14

Invitrogen™ Human CDS2 (aa 1-67) Control Fragment Recombinant Protein

Recombinant Protein

Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWK
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human CDS2 (aa 1-67) Control Fragment
Recombinant Recombinant
15

Invitrogen™ Human ABCG8 (aa 299-415) Control Fragment Recombinant Protein

Recombinant Protein

Regulatory Status RUO
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Conjugate Unconjugated
Form Liquid
Formulation 1 M urea, PBS with no preservative; pH 7.4
Sequence HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay,Control
Name Human ABCG8 (aa 299-415) Control Fragment
Recombinant Recombinant