Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (8)
- (1)
- (18)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (9)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (33,995)
For Use With (Application)
- (2)
- (926)
- (79)
- (3)
- (1)
- (1)
- (1)
- (123)
- (1,028)
- (3)
- (2)
- (7)
- (21,447)
- (2)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (1)
- (5)
- (10)
- (22,399)
- (1)
- (2)
- (1)
- (9)
- (1)
- (2,393)
- (175)
- (8)
- (1)
- (31)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (22)
- (4,023)
- (160)
- (1)
- (1)
- (1)
- (4)
- (1)
- (29)
- (25)
- (3)
- (15)
- (42)
- (7)
- (35)
- (41)
- (32)
- (1)
- (13)
- (1)
- (1,226)
- (1)
- (18)
- (26)
- (1)
- (2)
- (1)
- (1)
- (18)
- (2)
- (191)
- (1)
- (4)
- (1)
- (26)
- (2)
- (6)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (91)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (3,735)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (2)
- (5)
- (1)
- (2,099)
- (205)
- (1)
- (1)
Recombinant
- (69)
- (33,163)
Form
- (1)
- (23,202)
- (5,069)
- (29)
- (146)
- (26)
- (35)
Species
- (2)
- (72)
- (4)
- (30)
- (2)
- (1)
- (2)
- (2)
- (353)
- (1)
- (1)
- (1)
- (25,999)
- (1)
- (1)
- (4)
- (1)
- (551)
- (1)
- (7)
- (6)
- (1)
- (2)
- (1)
- (11)
- (95)
- (4)
- (2)
- (8)
- (3)
- (2)
- (179)
- (15)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
30,640
results
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | MSVNVNRSVSDQFYRYKMPRLIAKVEGKGNGIKTVIVNMVDVAKALNRPPTYPTKYFGCELGAQTQFDVKNDRYIVNGSHEANKLQDMLDGFIKKFVLCPECENPETDLHVNPKKQTIGNSCKACGYRGMLDTHHKLCTFILKNPPENSD |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human eIF5 (aa 1-150) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | LHEKSQEVIWGLQEQLQDTARGPEPEQMGLAPCCTQALCGLALRHHSHLQQIRREAEAELSGELSGLGALPARRDLTLELEEPPQGPLPRGSQRSEQLELERALKL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human NINL (aa 682-787) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VCQSSPCEAEELRYSLHVGPWSTCSMPHSRQVRQARRRGKNKEREKDRSKGVKDPEARELIKKKRNRNRQNRQENKYWDIQIGYQTREVMCINKTGKAADLSFCQQEKLPMTFQSC |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human THSD7A (aa 240-355) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | NGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEG |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human SYNJ2BP (aa 2-113) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | CSKEMPRKAHSNMLTVKALHVCPESGRSPQECCLRVSLMPLRLNIDQDALFFLKDFFTSLSAEVELQMTPDPEVKKSPGADVTCSLPRHLSTSKEPNLVISFSGPKQPSQNDSANSVEVVNGMEEKNFSAEEASFRDQPV |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human ATG2B (aa 1667-1806) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWY |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human PABPN1 (aa 161-303) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | IPWLLSPESLDIKEINGNKITCRGLVEYFKAYIKIYQGEELPHPKSMLQATAEANNLAAVATAKDTYNKKMEEICGGDKPFLAPNDLQTKHLQLKEESVKLFRGVKKMGGEEFSRRYLQQLESE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human ATL1 (aa 301-424) Control Fragment |
| Recombinant | Recombinant |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | SENP1 |
| Gene Symbol | SENP1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGK |
| Concentration | 1.60 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human SENP1 (aa 85-204) Control Fragment |
| Accession Number | Q9P0U3 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | 2310046A20Rik; D15Ertd528e; E330036L07Rik; SEN1; Senp1; sentrin/SUMO-specific protease SENP1; Sentrin-specific protease 1; SUMO-1 protease 2; SUMO1/sentrin specific peptidase 1; SUMO1/sentrin specific protease 1; Sumo1/sentrin/SMT3 specific peptidase 1; Supr2; suPr-2 |
| Product Type | Protein |
| Gene ID (Entrez) | 29843 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | EELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQ |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human LPXN (aa 2-50) Control Fragment |
| Recombinant | Recombinant |
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | MALRD1 |
| Gene Symbol | MALRD1 |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | SSGSKEGSVARITTSKSFPASLGMCTVRFWFYMIDPRSMGILKVYTIEESGLNILVWSVIGNK |
| Concentration | 3 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human MALRD1 (aa 1784-1846) Control Fragment |
| Accession Number | Q5VYJ5 |
| Regulatory Status | RUO |
| Purification Method | Metal-chelate chromatography |
| Gene Alias | bA265G8.2; C10orf112; DIET1; MALRD1; MAM and LDL receptor class A domain containing 1; MAM and LDL-receptor class A domain-containing protein 1; MAM and LDL-receptor class A domain-containing protein C10orf112; novel MAM domain containing protein |
| Product Type | Protein |
| Gene ID (Entrez) | 340895 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | MELDKFLEDVRNGIYPLMNFAATRPLGLPRVLAPPPEEVQKAKTPTPEPFDSETRKVIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASELVHYGFLHEDDRMKLAAFLESTF |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human NRBP2 (aa 366-493) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | DFKQVLHSWFRQPQSNWGIEINAFDPSGTDLAVTSLGPGAEGLHPFMELRVLENT |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human GDF11 (aa 239-293) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYET |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human E2F1 (aa 61-130) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | NVTANDLQENITKLNSGMAFMIKHSQKLFKAPAYIRECARLHYLGSRTQASKDDLDLIASCHTKSFQLAKSQKRNRVDSCPHQEETQHHTEEALREL |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human ARHGAP19 (aa 280-376) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | SSPPASPVPACSQQQVIQHNTITTSSSVSEV |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CREB5 (aa 458-488) Control Fragment |
| Recombinant | Recombinant |