missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TrxR1 (aa 377-439) Control Fragment Recombinant Protein

Numéro de catalogue. RP104781
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP104781 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP104781 Fournisseur Invitrogen™ Code fournisseur RP104781
Il en reste null

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111192 (PA5-111192. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the family of pyridine nucleotide oxidoreductases. This protein reduces thioredoxins as well as other substrates, and plays a role in selenium metabolism and protection against oxidative stress. The functional enzyme is thought to be a homodimer which uses FAD as a cofactor. Each subunit contains a selenocysteine (Sec) residue which is required for catalytic activity. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenocysteine-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing results in several transcript variants encoding the same or different isoforms.

Spécifications

Accession Number Q16881
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7296
Name Human TrxR1 (aa 377-439) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias gene associated with retinoic and IFN-induced mortality 12 protein; gene associated with retinoic and interferon-induced mortality 12 protein; GRIM12; GRIM-12; KDRF; KM-102-derived reductase-like factor; MGC9145; NADPH-dependent thioredoxin reductase; oxidoreductase; selenoprotein oxidoreductase; testis tissue sperm-binding protein Li 46 A; thioredoxin reductase 1; thioredoxin reductase 1, cytoplasmic; thioredoxin reductase GRIM-12; thioredoxin reductase TR1; TR; TR alpha; TR1; Trxr1; TXNR; Txnrd1
Common Name TrxR1
Gene Symbol TXNRD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats