missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90991

Invitrogen™ Human TMEM263 (aa 8-37) Control Fragment Recombinant Protein

Numéro de catalogue. RP90991
Modifier l'affichage
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP90991 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP90991 Fournisseur Invitrogen™ Code fournisseur RP90991
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-139752 (PA5-139752, PA5-59952 (PA5-59952. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TMEM263 is a protein coding gene.

Spécifications

Accession Number Q8WUH6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90488
Name Human TMEM263 (aa 8-37) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI597468; C10H12orf23; C12orf23; C28H12orf23; C5H12orf23; fc21f01; hypothetical protein LOC539347; hypothetical protein MGC17943; RGD1563325; si:dkey-227k11.2; Tmem263; Transmembrane protein 263; UPF0444 transmembrane protein C12orf23; UPF0444 transmembrane protein C12orf23 homolog; wu:fc21f01; zgc:64098
Common Name TMEM263
Gene Symbol TMEM263
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats