missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104161

Invitrogen™ Human SFPQ (aa 640-703) Control Fragment Recombinant Protein

Numéro de catalogue. RP104161
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP104161 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP104161 Fournisseur Invitrogen™ Code fournisseur RP104161
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83870 (PA5-83870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SFPQ, also named PSF, encodes a nuclear factor implicated in the splicing and regulation of gene expression. SFPQ probably forms a heteromer with NONO and participates in DNA pairing and DNA break repair program. Very recently SFPQ was identified as a downstream target of tau, complete nuclear depletion and cytoplasmic accumulation of SFPQ were shown in the neurons and astrocytes of brains with Alzheimer's disease (AD), more strikingly, reduced SFPQ levels may progress together with tau pathology, these observation strongly suggests the important role of SFPQ pathology in neurodegenerative diseases including AD. SFPQ protein may appears as 47 kDa, 52 kDa or 100 kDa molecules in various cell types.

Spécifications

Accession Number P23246
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6421
Name Human SFPQ (aa 640-703) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 100 kDa DNA-pairing protein; 1110004P21Rik; 2810416M14Rik; 5730453G22Rik; 9030402K04Rik; AU021830; D4Ertd314e; DNA-binding p52/p100 complex, 100 kDa subunit; Gm12940; hPOMp100; NonO/p54nrb homolog; OTTMUSG00000009329; polypyrimidine tract binding protein associated; polypyrimidine tract-binding protein-associated splicing factor; polypyrimidine tract-binding protein-associated-splicing factor; POMP100; PPP1R140; protein phosphatase 1, regulatory subunit 140; PSF; PTB-associated splicing factor; PTB-associated-splicing factor; REP1; Sfpq; splicing factor proline and glutamine rich; splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated); splicing factor proline/glutamine rich (polypyrimidine tract-binding protein-associated); splicing factor proline/glutamine-rich; splicing factor, proline- and glutamine-rich
Common Name SFPQ
Gene Symbol SFPQ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IGYEANPGVPPATMSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats