missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96657

Invitrogen™ Human PSA (aa 93-235) Control Fragment Recombinant Protein

Numéro de catalogue. RP96657
Modifier l'affichage
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP96657 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP96657 Fournisseur Invitrogen™ Code fournisseur RP96657
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PSA is a chymotrypsin-like serine protease (kallikrein family) produced by the prostate epithelium, and is abundant in seminal fluid. PSA can be detected in the sera of patients with prostatic carcinoma. It is predominantly complexed to a liver-derived serine protease inhibitor, alpha-1-antichymotrypsin (ACT). A higher proportion of serum PSA is complexed to ACT in prostate cancer than in benign prostate hyperplasia. PSA is used to confirm prostatic acinar cell origin in primary and metastatic carcinoma and to rule out non-prostatic carcinoma mimics.

Spécifications

Accession Number P07288
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 354
Name Human PSA (aa 93-235) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Antigen; antigen, prostate specific; APS; Fletcher factor; gamma-seminoprotein; hK3; Kal3; Kal-3; Kallikrein 3; kallikrein 3, plasma; kallikrein B, plasma 1; kallikrein related peptidase 3; kallikrein-3; Kallikrein-3 (KLK3); kallikrein-related peptidase 3; Kalp1; KALP15; Kininogenin; KLK2A1; Klk3; KLK-3; Klkb1; P-30 antigen; Pk.; Plasma kallikrein; Plasma kallikrein heavy chain; Plasma kallikrein light chain; Plasma prekallikrein; prostate specific antigen; prostate-specific (APS); prostate-specific antigen; PSA; Semenogelase; seminin
Common Name PSA
Gene Symbol KLK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats