missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human KIDINS220 (aa 1016-1117) Control Fragment Recombinant Protein

Numéro de catalogue. RP91147
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP91147 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP91147 Fournisseur Invitrogen™ Code fournisseur RP91147
Il en reste null

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82511 (PA5-82511. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a transmembrane protein that is preferentially expressed in the nervous system where it controls neuronal cell survival, differentiation into exons and dendrites, and synaptic plasticity. The encoded protein interacts with membrane receptors, cytosolic signaling components, and cytoskeletal proteins, serving as a scaffold that mediates crosstalk between the neurotrophin pathway and several other intracellular signaling pathways. Aberrant expression of this gene is associated with the onset of various neuropsychiatric disorders and neurodegenerative diseases, including Alzheimer's disease. Naturally occurring mutations in this gene are associated with a syndrome characterized by spastic paraplegia, intellectual disability, nystagmus and obesity. Alternative splicing results in multiple transcript variants.

Spécifications

Accession Number Q9ULH0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57498
Name Human KIDINS220 (aa 1016-1117) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110039L19Rik; AI194387; AI316525; ankyrin repeat-rich membrane spanning; ankyrin repeat-rich membrane spanning protein; ankyrin repeat-rich membrane-spanning protein; ARMS; C330002I19Rik; KIAA1250; KIDINS220; kinase D-interacting substance 220; kinase D-interacting substance of 220 kDa; kinase D-interacting substrate 220; kinase D-interacting substrate 220 kDa; kinase D-interacting substrate of 220 kDa; kinase D-interacting substrate, 220 kDa; MGC163482; mKIAA1250; truncated KIDINS220
Common Name KIDINS220
Gene Symbol Kidins220
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EPLLEIDGDIRNFEVFLSSRTPVLVARDVKVFLPCTVNLDPKLREIIADVRAAREQISIGGLAYPPLPLHEGPPRAPSGYSQPPSVCSSTSFNGPFAGGVVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats