missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105426

Invitrogen™ Human GABPB1 (aa 321-371) Control Fragment Recombinant Protein

Numéro de catalogue. RP105426
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP105426 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP105426 Fournisseur Invitrogen™ Code fournisseur RP105426
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66923 (PA5-66923. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor capable of interacting with purine rich repeats (GA repeats). Necessary for the expression of the Adenovirus E4 gene.

Spécifications

Accession Number Q06547
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2553
Name Human GABPB1 (aa 321-371) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BABPB2; E4TF1; E4TF1-47; E4TF1-53; E4Tf1B; GA binding protein subunit beta1; GA binding protein transcription factor beta subunit 1; GA binding protein transcription factor beta subunit 1 transcript variant gamma-2; GA binding protein transcription factor, beta subunit 1; GA repeat binding protein, beta 1; GA-binding protein subunit beta-1; Gabp beta1; GABP subunit beta-1; GABP subunit beta-2; GABPB; Gabpb1; GABPB-1; GABPB1-1; GABPB1-2; GABPB2; GABPB-2; NRF2B1; NRF2B2; Nuclear respiratory factor 2; RGD1560391; transcription factor E4TF1-47; Transcription factor E4TF1-53
Common Name GABPB1
Gene Symbol GABPB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats