Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate
- (11)
- (1)
- (4)
- (2)
- (9)
- (8)
- (1)
- (18)
- (1)
- (3)
- (1)
- (1)
- (3)
- (2)
- (1)
- (9)
- (2)
- (1)
- (13)
- (5)
- (1)
- (2)
- (3)
- (33,995)
For Use With (Application)
- (2)
- (926)
- (79)
- (3)
- (1)
- (1)
- (1)
- (123)
- (1,028)
- (3)
- (2)
- (7)
- (21,447)
- (2)
- (1)
- (1)
- (2)
- (6)
- (44)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (3)
- (1)
- (1)
- (3)
- (1)
- (5)
- (10)
- (22,399)
- (1)
- (2)
- (1)
- (9)
- (1)
- (2,393)
- (175)
- (8)
- (1)
- (31)
- (8)
- (2)
- (1)
- (8)
- (1)
- (1)
- (1)
- (22)
- (4,023)
- (160)
- (1)
- (1)
- (1)
- (4)
- (1)
- (29)
- (25)
- (3)
- (15)
- (42)
- (7)
- (35)
- (41)
- (32)
- (1)
- (13)
- (1)
- (1,226)
- (1)
- (18)
- (26)
- (1)
- (2)
- (1)
- (1)
- (18)
- (2)
- (191)
- (1)
- (4)
- (1)
- (26)
- (2)
- (6)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (91)
- (3)
- (6)
- (1)
- (1)
- (6)
- (7)
- (5)
- (1)
- (1)
- (3,735)
- (6)
- (3)
- (14)
- (2)
- (4)
- (4)
- (2)
- (5)
- (1)
- (2,099)
- (205)
- (1)
- (1)
Recombinant
- (69)
- (33,163)
Form
- (1)
- (23,202)
- (5,069)
- (29)
- (146)
- (26)
- (35)
Species
- (2)
- (72)
- (4)
- (30)
- (2)
- (1)
- (2)
- (2)
- (353)
- (1)
- (1)
- (1)
- (25,999)
- (1)
- (1)
- (4)
- (1)
- (551)
- (1)
- (7)
- (6)
- (1)
- (2)
- (1)
- (11)
- (95)
- (4)
- (2)
- (8)
- (3)
- (2)
- (179)
- (15)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
1
–
15
of
30,640
results
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
|---|---|
| Conjugate | Unconjugated |
| pH Range | 7.4 |
| Form | Liquid |
| Common Name | Insulin |
| Gene Symbol | INS |
| Storage Requirements | -20°C, Avoid Freeze/Thaw Cycles |
| Sequence | SHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYC |
| Concentration | 2.2 mg/mL |
| Expression System | E. coli |
| For Use With (Application) | Neutralization,Control |
| Name | Human Insulin (aa 33-109) Control Fragment |
| Accession Number | P01308 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | AA986540; IDDM; IDDM1; IDDM2; ILPR; INS; Ins1; Ins-1; Ins2; Ins-2; Ins2-rs1; InsII; Insulin; insulin 1; insulin 2; Insulin A chain; Insulin B chain; insulin I; insulin II; insulin-1; Insulin-1 A chain; Insulin-1 B chain; Insulin-2; Insulin-2 A chain; Insulin-2 B chain; IRDN; Mody; MODY10; Mody4; preproinsulin; proinsulin |
| Product Type | Protein |
| Gene ID (Entrez) | 3630 |
| Formulation | PBS, 1M urea with no preservative; pH 7.4 |
| Protein Tag | His-ABP-tag |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human ASNA1 (aa 25-108) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | GDDDSFPDDELDDLYSGSGSGYFEQESGIETAMRFSPDVALAVSTTPAVLPTTNIQPVGTPFEELPSERPTLEPATSPLVVTEVPEEPSQRATTVSTTMATTA |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Syndecan 3 (aa 65-167) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | MTSAMARGAYGRPGSDFCHGTEGKDLPSEHNVSVEGVAQDRSPEATLCPQKTCPCDICGLR |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human ZNF792 (aa 80-140) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | RGRSHGARSVGRSAHIQASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAPGRRKQRLRLSVFQQGV |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CENPT (aa 60-166) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | VRPASMTYDDIPHLSAKIKPKQQKVELEMAIDTLNPNYCRSKGEQIALNVDGACADETSTYSSKLMDKQTFCSSQTTSNTSRYAAALYRQGELHLTPLHGILQLRPSFSYLDK |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human POLR3E (aa 32-144) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human XPB (aa 157-263) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | TLNPPGTFLEGVAKVGQYTFT |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human NDUFA11 (aa 42-62) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Gemin 2 (aa 238-280) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | QGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCC |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human TREF1 (aa 719-834) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | FDILSVVDLNPRGVDLYLRILMAIDSELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVGAY |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human XPOT (aa 126-212) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | RFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human Cyclin D1 (aa 231-295) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | LYQLLNLHYPPKLEGQAQAEAKAGEGTYALDSESCMEKLAALSASLARVVVPATEEEAEVDEFPTDGEMSAQEEDRRKE |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human PES1 (aa 238-316) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | HLAPFTDEQLYMEQFTKANFWYQPSFHGVDLSALRGAAVDEYFRQPVVDTFDIRILMAKSVKYTVNFLEAKEGDLHRIEIPFKFHMLHSGLVHGLAFWFDVAFI |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human PRMT4 (aa 293-396) Control Fragment |
| Recombinant | Recombinant |
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
| Conjugate | Unconjugated |
| Form | Liquid |
| Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
| Sequence | TLVWDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLA |
| Concentration | ≥5.0 mg/mL |
| For Use With (Application) | Blocking Assay,Control |
| Name | Human CARD8 (aa 425-513) Control Fragment |
| Recombinant | Recombinant |