missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. NBP258903PE

Novus Biologicals™ Serine racemase Recombinant Protein Antigen

Numéro de catalogue. NBP258903PE
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
NBP258903PE 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. NBP258903PE Fournisseur Novus Biologicals™ Code fournisseur NBP258903PEP
Il en reste null

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Serine racemase. Source: E.coli Amino Acid Sequence: QVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQ The Serine racemase Recombinant Protein Antigen is derived from E. coli. The Serine racemase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Spécifications

Gene ID (Entrez) 63826
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name Serine racemase Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias D-serine ammonia-lyase, D-serine dehydratase, EC 4.3.1.17, EC 4.3.1.18, EC 5.1.1.18, ILV1, ISO1, L-serine ammonia-lyase, L-serine dehydratase, serine racemase
Gene Symbol SRR
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51059. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Afficher plus de résultats Afficher moins de résultats

For Research Use Only.