missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. R&D Systems™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

R&D Systems™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Numéro de catalogue. NB254789100
Modifier l'affichage
Click to view available options
Quantité:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
NB254789100 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. NB254789100 Fournisseur R&D Systems™ Code fournisseur NBP254789100UG

Pour de l'aide SVP utiliser la function de clavardage; nous envoyer un couriel à help@thermofisher.com ou appelez le service à la clientèle au 1-800-234-7437.

Description

A Novus product, part of R&D Systems. Highly purified and high bioactivity. Generating reliable and reproducible results.

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.

Spécifications

À utiliser avec (application) In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formule PBS
ID du gène (Entrez) 6622
Nom Human alpha-Synuclein Aggregate Protein
Méthode de purification >95% pure by SDS-PAGE
Quantité 100 μg
Sources E.Coli
Immunogène MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Conditions de stockage Store at −80°C. Avoid freeze-thaw cycles.
Statut réglementaire RUO
Alias du gène alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Symbole de gène SNCA
Activité biologique Endogenous alpha-synuclein phosphorylation. 100μM alpha synuclein protein monomer seeded with 10nM alpha synuclein protein aggregate in 25μM Thioflavin T (PBS pH 7.4, 100μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37°C with shaking at 600 rpm for 24 hours. Fluorescence was measured by excitation at 450nm and emission at 485nm on a Molecular Devices Gemini XPS microplate reader.
Type de produit Recombinant Protein
Conjugué Unconjugated
Réactivité croisée Human
Recombinant Recombinant
Gamme de produit Novus
Afficher plus de résultats Afficher moins de résultats