missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89019910

MPPED1, Mouse anti-Human, Polyclonal Antibody, Abnova™

Numéro de catalogue. 89019910
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
89019910 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. 89019910 Fournisseur Abnova Corporation Code fournisseur H00000758B02P
Il en reste null

Description

Mouse Polyclonal Antibody

Sequence: MWRSRWDASVLKAEALALLPCGLGMAFSQSHVMAARRHQHSRLIIEVDEYSSNPTQAFTFYNINQGRFQPPHVQMVDPVPHDAPKPPGYTRFVCVSDTHSRTDPIQMPYGDVLIHAGDFTELGLPSEVKKFNEWLGSLPYEYKIVIAGNHELTFDQEFMADLIKQDFYYFPSVSKLKPENYENVQSLLTNCIYLQDSEVTVRGFRIYGSPWQPWFYGWGFNLPRGQALLEKWNLIPEGVDILITHGPPLGFLDWVPKKMQRVGCVELLNTVQRRVQPRLHVFGHIHEGYGVMADGTTTYVNASVCTVNYQPVNPPIVIDLPTPRNS

Spécifications

Antigen MPPED1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene metallophosphoesterase domain containing 1
Gene Accession No. NM_001585.2
Gene Alias 239AB/C22orf1/FAM1A/MGC88045
Gene Symbols MPPED1
Host Species Mouse
Immunogen MPPED1 (NP_001576.3, 1 a.a. ∼ 326 a.a) full-length human protein.
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 758
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Afficher plus de résultats Afficher moins de résultats