missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP101118

Invitrogen™ Human ZNF446 (aa 336-399) Control Fragment Recombinant Protein

Numéro de catalogue. RP101118
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP101118 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP101118 Fournisseur Invitrogen™ Code fournisseur RP101118
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140015 (PA5-140015. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZNF446 contains a KRAB and three C(2)H(2) zinc fingers. ZNF446 is a transcription repressor when fused to GAL4 DNA-binding domain and co-transfected with VP-16. Overexpression of ZNF446 in COS-7 cells inhibits the transcriptional activities of SRE.

Spécifications

Accession Number Q9NWS9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55663
Name Human ZNF446 (aa 336-399) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FLJ20626; Zinc finger protein 446; zinc finger protein with KRAB and SCAN domains 20; ZKSCAN20; ZNF446; ZSCAN30; ZSCAN52
Common Name ZNF446
Gene Symbol ZNF446
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRRSLTGPRSYPCEE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats