missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TIMD4 (aa 190-311) Control Fragment Recombinant Protein

Numéro de catalogue. RP90600
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP90600 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP90600 Fournisseur Invitrogen™ Code fournisseur RP90600
Il en reste null

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53346 (PA5-53346. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The T cell immunoglobulin and mucin domain containing protein (TIM) family encodes cell surface receptors that are involved in the regulation of T helper (Th) -1 and -2 cell-mediated immunity. TIM-4, which is preferentially expressed on macrophages and dendritic cells, is the natural ligand of TIM-1, and this binding leads to T-cell expansion and cytokine production. Unlike other members of the TIM family, TIM-4 lacks a putative tyrosine phosphorylation signal sequence in its intracellular domain. The TIM-4 gene maps to a locus associated with predisposition to asthma in both mice and humans and with its connection to TIM-1-triggered Th2 responsiveness, may be considered as a candidate disease/predisposition gene for asthma.

Spécifications

Accession Number Q96H15
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91937
Name Human TIMD4 (aa 190-311) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B430010N18Rik; RGD1564516; smuckler; soluble TIM 4; Spleen, mucin-containing, knockout of lymphotoxin protein; sTIM 4; T cell immunoglobulin and mucin domain containing 4; T-cell immunoglobulin and mucin domain containing 4; T-cell immunoglobulin and mucin domain-containing protein 4; T-cell immunoglobulin mucin receptor 4; T-cell membrane protein 4; Tim4; TIM-4; TIMD4; TIMD-4
Common Name TIM-4 (TIMD4)
Gene Symbol TIMD4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VFTTANTCLSLTPSTLPEEATGLLTPEPSKEGPILTAESETVLPSDSWSSVESTSADTVLLTSKESKVWDLPSTSHVSMWKTSDSVSSPQPGASDTAVPEQNKTTKTGQMDGIPMSMKNEMP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats