missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP105505

Invitrogen™ Human TCF7 (aa 181-265) Control Fragment Recombinant Protein

Numéro de catalogue. RP105505
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP105505 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP105505 Fournisseur Invitrogen™ Code fournisseur RP105505
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84842 (PA5-84842. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TCF7 (transcriptional factor 7) is a transcriptional activator involved in T-cell lymphocyte differentiation. Necessary for the survival of CD4+ and CD8+ immature thymocytes. Isoforms for TCF7 lacking the N-terminal CTNNB1 binding domain cannot fulfill this role. TCF7 binds to the T-lymphocyte-specific enhancer element (5'-WWCAAAG-3') found in the promoter of the CD3E gene. It may also act as feedback transcriptional repressor of CTNNB1 and TCF7L2 target genes. TLE1, TLE2, TLE3, and TLE4 repress transactivation mediated by TCF7 and CTNNB1.

Spécifications

Accession Number P36402
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6932
Name Human TCF7 (aa 181-265) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI465550; HMG-box; OTTHUMP00000159390; OTTHUMP00000159391; T cell factor-1; T-cell factor 1; T-cell specific; T-cell-specific transcription factor 1; Tcf1; TCF-1; Tcf7; TCF-7; Transcription factor 7; transcription factor 7 (T-cell specific, HMG-box); transcription factor 7, T cell specific; transcription factor 7, T-cell specific
Common Name TCF7
Gene Symbol TCF7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats