missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90807

Invitrogen™ Human STEAP2 (aa 131-202) Control Fragment Recombinant Protein

Numéro de catalogue. RP90807
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP90807 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP90807 Fournisseur Invitrogen™ Code fournisseur RP90807
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The six-transmembrane epithelial antigen of prostate 2 (STEAP2) is a member of a family of metalloreductases identified as cell-surface antigens in prostate tissue. Similar to two other members of the STEAP family (STEAP 3 and STEAP4), STEAP2 promotes both iron and copper reduction. STEAP2 expression in transfected cells also correlated with iron or copper uptake, suggesting that the STEAP family of proteins may function to stimulate iron and copper uptake. STEAP2 is widely expressed in many tissues in the plasma membrane, but is most highly expressed in prostate. At least three isoforms of STEAP2 are known to exist.

Spécifications

Accession Number Q8NFT2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 261729
Name Human STEAP2 (aa 131-202) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921538B17Rik; AI930049; AW045895; IPCA1; IPCA-1; Metalloreductase STEAP2; PCANAP1; prostate cancer associated protein 1; prostate cancer-associated protein 1; protein upregulated in metastatic prostate cancer; Protein up-regulated in metastatic prostate cancer; PUMPCn; six transmembrane epithelial antigen of prostate 2; six transmembrane epithelial antigen of the prostate 2; six-transmembrane epithelial antigen of prostate 2; SixTransMembrane protein of prostate 1; STAMP1; STEAP family member 2, metalloreductase; Steap2; STEAP2 metalloreductase; STMP; UNQ6507/PRO23203
Common Name STEAP2
Gene Symbol STEAP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EYLASLFPDSLIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats