missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP104934

Invitrogen™ Human SOX13 (aa 543-621) Control Fragment Recombinant Protein

Numéro de catalogue. RP104934
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP104934 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP104934 Fournisseur Invitrogen™ Code fournisseur RP104934

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111341 (PA5-111341. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. It has also been determined to be a type-1 diabetes autoantigen, also known as islet cell antibody 12.

Spécifications

Numéro d'enregistrement Q9UN79
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 9580
Nom Human SOX13 (aa 543-621) Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène AA407916; AW259412; AW540933; ICA12; islet cell antibody 12; islet cell antigen 12; MGC117216; mSo x 13; RP11-74C13.1; SO x 13; Sox-13; SRY (Sex determining region Y)-box 13; SRY box 13; SRY-box 13; SRY-box containing gene 13; SRY-related HMG-box gene 13; transcription factor SOX-13; Type 1 diabetes autoantigen ICA12
Nom usuel SOX13
Symbole de gène SOX13
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats