missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SLITRK3 (aa 762-904) Control Fragment Recombinant Protein

Numéro de catalogue. RP108201
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP108201 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP108201 Fournisseur Invitrogen™ Code fournisseur RP108201
Il en reste null

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83892 (PA5-83892. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SLIT and NTRK-like family 3 (Slitrk3) is a member a protein family consisting of six homologous transmembrane proteins (Slitrk1-6) that share two conserved leucine-rich repeat domains in the extracellular domain and have significant homology to Slit, a secreted axonal growth-controlling protein. These proteins are also homologous to trk neurotrophin receptors in their intracellular domains. Expression of Slitrk proteins is highly restricted to neural and brain tumor tissues, but varies within the protein family. Like every other Slitrk protein except Slitrk1, overexpression of Slitrk3 inhibited neurite outgrowth in cultured neurons, suggesting that these proteins are involved in the control of neurite outgrowth.

Spécifications

Accession Number O94933
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 22865
Name Human SLITRK3 (aa 762-904) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias KIAA0848; SLIT and NTRK like family member 3; SLIT and NTRK-like family, member 3; SLIT and NTRK-like protein 3; slit and trk like gene 3; SLITRK3
Common Name SLITRK3
Gene Symbol SLITRK3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EEVAVSSAQEAGSAERGGPGTQPPGMGEALLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSSQLNTIVTVNHHHPHHPAVGGVSGVVGGTGGDLAGFRHHEKNGGVVLFPPGGGCGSGSMLLDRERPQPAPCTVGFVDCLY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats