missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94357

Invitrogen™ Human RUSC1 (aa 805-885) Control Fragment Recombinant Protein

Numéro de catalogue. RP94357
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP94357 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP94357 Fournisseur Invitrogen™ Code fournisseur RP94357
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56299 (PA5-56299. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RUSC1, also known as NESCA, shares with the related protein RUSC2 a common domain structure of RUN, leucine zipper and SH3 domain in addition to over 30% amino acid identity. RUSC1 is an adapter protein that can bind to the TrkA receptor and is necessary in the NGF-induced neurite growth of PC12 cells. RUSC1 has also been shown to interact with Ikappa-B kinase- (IKK-) -gamma, the regulatory subunit of the IKK complex that is required for NF-kappa-B activation in many signaling pathways such as TNF-R or the TLR pathways. RUSC1 can also bind to the E3 ubiquitin ligase TRAF6, which then catalyzes RUSC1 polyubiquitination. Since overexpression of RUSC1 strongly inhibits TRAF6-mediated polyubiquitination of IKK-gamma, RUSC1 may be a link in the IKK-gamma-mediated NF-kappa-B activation pathway.

Spécifications

Accession Number Q9BVN2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23623
Name Human RUSC1 (aa 805-885) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2210403N08Rik; AA408288; LOC100360417; Nesca; new molecule containing SH3 at the carboxy-terminus; RP11-21N7.4; RUN and SH3 domain containing 1; RUN and SH3 domain containing 1-like; RUN and SH3 domain-containing protein 1; RUSC1
Common Name RUSC1
Gene Symbol RUSC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats