missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP89529

Invitrogen™ Human RET (aa 702-848) Control Fragment Recombinant Protein

Numéro de catalogue. RP89529
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP89529 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP89529 Fournisseur Invitrogen™ Code fournisseur RP89529

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The receptor tyrosine kinase RET is a member of the cadherin superfamily. RET plays a crucial role in neural crest development, and can undergo oncogenic activation by cytogenetic rearrangement. RET transduce signals for cell growth and differentiation. Mutations in the RET gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for the RET gene. Additional transcript variants have been described for RET but their biological validity has not been confirmed.

Spécifications

Numéro d'enregistrement P07949
Concentration ≥5.0 mg/mL
À utiliser avec (application) Neutralization, Control
Formule PBS, 1M urea with no preservative; pH 7.4
ID du gène (Entrez) 5979
Nom Human RET (aa 702-848) Control Fragment
Plage de pH 7.4
Méthode de purification Purified
Quantité 100 μL
Conditions de stockage -20°C, Avoid Freeze/Thaw Cycles
Statut réglementaire RUO
Alias du gène Cadherin family member 12; Cadherin family member 12 (CDHF12); Cadherin related family member 16 (CDHR16); cadherin-related family member 16; CDHF12; CDHR16; CG1061; CG14396; CG14396-PA; CG14396-PB; CG14396-PC; c-Ret; CUX1/RET fusion; Dmel\CG14396; Dmel_CG14396; DmHD-59; DmRet; Dret; D-ret; EC 2.7.10.1; ELKS; Extracellular cell-membrane anchored RET cadherin 120 kDa fragment; HD-59; HSCR1; Hydroxyaryl protein kinase; hydroxyaryl-protein kinase; kinase Ret; MEN2; MEN2A; MEN2B; MTC1; Multiple endocrine neoplasia and medullary thyroid carcinoma 1; Oncogene RET; OTTHUMP00000216967; proto-oncogene c-Ret; Proto-oncogene tyrosine-protein kinase receptor Ret; PTC; rearranged during transfection; receptor tyrosine kinase; ret; RET ELE1; Ret gene for receptor tyrosin; Ret oncogene; ret proto-oncogene; ret proto-oncogene (multiple endocrine neoplasia and medullary thyroid carcinoma 1, Hirschsprung disease); Ret proto-oncogene (multiple endocrine neoplasia MEN2A MEN2B and medullary thyroid carcinoma 1 Hirschsprung disease); RET receptor tyrosine kinase; RET transforming sequence; RET51; RET9; RET-ELE1; Reto; Ret-PA; Ret-PB; Ret-PC; Soluble RET kinase fragment
Nom usuel RET
Symbole de gène RET
Type de produit Protein
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence NQVSVDAFKILEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTM
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats