missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP98418

Invitrogen™ Human PZP (aa 611-671) Control Fragment Recombinant Protein

Numéro de catalogue. RP98418
Modifier l'affichage
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP98418 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP98418 Fournisseur Invitrogen™ Code fournisseur RP98418

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (51%), Rat (51%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59582 (PA5-59582. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is highly expressed in late-pregnancy serum and is similar in structure to alpha-2-macroglobulin. The encoded protein, which acts as a homotetramer, inhibits the activity of all four classes of proteinases. This protein contains cleavage sites for several proteinases. Upon binding of a proteinase, the conformation of this protein changes to trap the proteinase, limiting its activity. This protein appears to be elevated in the sera of presymptomatic Alzheimer's disease patients.

Spécifications

Accession Number P20742
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5858
Name Human PZP (aa 611-671) Control Fragment
Quantity 100 μL
Gene Alias A1m; A1m {ECO:0000312; A2m; AI893533; alpha 1 macroglobulin; alpha-1-M; Alpha-1-macroglobulin; alpha-1-macroglobulin 165 kDa subunit; Alpha-1-macroglobulin 45 kDa subunit; alpha-2-M; alpha-2-macroglobulin; C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6; CPAMD6; EMBL:AAA40723.1}; MAM; Pregnancy zone protein; pregnancy-zone protein; Pzp; PZP, alpha-2-macroglobulin like
Common Name PZP
Gene Symbol PZP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats