missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109839

Invitrogen™ Human PPP3CC (aa 275-312) Control Fragment Recombinant Protein

Numéro de catalogue. RP109839
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109839 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109839 Fournisseur Invitrogen™ Code fournisseur RP109839
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145072 (PA5-145072. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Calmodulin-dependent protein phosphatase, calcineurin, is involved in a wide range of biologic activities, acting as a Ca(2+)-dependent modifier of phosphorylation status. In testis, the motility of the sperm is thought to be controlled by cAMP-dependent phosphorylation and a unique form of calcineurin appears to be associated with the flagellum. The calcineurin holoenzyme is composed of catalytic and regulatory subunits of 60 and 18 kD, respectively. At least 3 genes, calcineurin A-alpha, calcineurin A-beta, and calcineurin A-gamma (CALNA3), have been cloned for the catalytic subunit. These genes have been identified in humans, mice, and rats, and are highly conserved between species (90 to 95% amino acid identity).

Spécifications

Accession Number P48454
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5533
Name Human PPP3CC (aa 275-312) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Calcineurin A gamma; Calcineurin, testis-specific catalytic subunit; calmodulin-dependent calcineurin A subunit gamma isoform; CALNA3; Calnc; CAM-PRP catalytic subunit; CNA3; PP2BA gamma; PP2Bgamma; PPP3CC; protein phosphatase 2 B, catalytic subunit, gamma isoform; protein phosphatase 3 (formerly 2 B), catalytic subunit, gamma isoform; protein phosphatase 3 (formerly 2 B), catalytic subunit, gamma isoform (calcineurin A gamma); protein phosphatase 3 catalytic subunit gamma; protein phosphatase 3, catalytic subunit, gamma isoform; protein phosphatase 3, catalytic subunit, gamma isozyme; serine/threonine-protein phosphatase 2 B catalytic subunit gamma isoform
Common Name PPP3CC
Gene Symbol PPP3CC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats