missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109699

Invitrogen™ Human PPP1R16B (aa 348-415) Control Fragment Recombinant Protein

Numéro de catalogue. RP109699
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109699 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109699 Fournisseur Invitrogen™ Code fournisseur RP109699
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140027 (PA5-140027. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is membrane-associated and contains five ankyrin repeats, a protein phosphatase-1-interacting domain, and a carboxy-terminal CAAX box domain. Synthesis of the encoded protein is inhibited by transforming growth factor beta-1. The protein may bind to the membrane through its CAAX box domain and may act as a signaling molecule through interaction with protein phosphatase-1. Alternatively spliced transcript variants encoding different isoforms have been identified in this gene.[provided by RefSeq, Feb 2010].

Spécifications

Accession Number Q96T49
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26051
Name Human PPP1R16B (aa 348-415) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ANKRD4; ankyrin repeat domain protein 4; ankyrin repeat domain-containing protein 4; C130078N17Rik; CAAX box protein TIMAP; hTIMAP; KIAA0823; PPP1R16B; Protein phosphatase 1 regulatory inhibitor subunit 16 B; protein phosphatase 1 regulatory subunit 16 B; protein phosphatase 1, regulatory (inhibitor) subunit 16 B; protein phosphatase 1, regulatory subunit 16 B; TGF-beta-inhibited membrane-associated protein; TIMAP; Wdt4; whn-dependent transcript 4
Common Name PPP1R16B
Gene Symbol PPP1R16B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RASLSDRTNLYRKEYEGEAILWQRSAAEDQRTSTYNGDIRETRTDQENKDPNPRLEKPVLLSEFPTKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats