missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP89902

Invitrogen™ Human PDE1A (aa 320-397) Control Fragment Recombinant Protein

Numéro de catalogue. RP89902
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP89902 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP89902 Fournisseur Invitrogen™ Code fournisseur RP89902
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82794 (PA5-82794. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cyclic nucleotide phosphodiesterases (PDEs) play a role in signal transduction by regulating intracellular cyclic nucleotide concentrations through hydrolysis of cAMP and/or cGMP to their respective nucleoside 5-prime monophosphates. Members of the PDE1 family, such as PDE1A, are Ca(2+)/calmodulin (see CALM1)that are activated by calmodulin in the presence of Ca(2+) (Michibata et al., 2001).

Spécifications

Accession Number P54750
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5136
Name Human PDE1A (aa 320-397) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3'-RACE clone 8 phosphodiesterase 1 A; 3-RACE clone 8 phosphodiesterase 1 A; 3'-RACEclone8phosphodiesterase1A; 3-RACEclone8phosphodiesterase1A; 61 kDa Cam-PDE; AI987702; AW125737; calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1 A; calcium/calmodulin-stimulated cyclic nucleotide phosphodiesterase; cam-PDE 1 A; CAM-PDE-1 A; HCAM1; hCam-1; HS MGC26303; HSPDE1A; MGC26303; Pde1a; phosphodiesterase 1 A; phosphodiesterase 1 A, calmodulin-dependent; phosphodiesterase-1 A
Common Name PDE1A
Gene Symbol PDE1A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGIDRAKTMSLILHAADISHPAKSWKLHYRWTMALMEEFFLQGDKEAE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats