missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP108107

Invitrogen™ Human PCDHA11 (aa 273-324) Control Fragment Recombinant Protein

Numéro de catalogue. RP108107
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP108107 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP108107 Fournisseur Invitrogen™ Code fournisseur RP108107
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67445 (PA5-67445. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potential calcium-dependent cell-adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain.

Spécifications

Accession Number Q9Y5I1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56138
Name Human PCDHA11 (aa 273-324) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A830022B16Rik; cadherin-related neuronal receptor 11; cadherin-related neuronal receptor 7; CNR7; CNRN7; CNRS7; CRNR7; KIAA0345-like 3; LOW QUALITY PROTEIN: protocadherin alpha-10; PCDHA11; PCDH-ALPHA11; PCDH-alpha-11; PCDH-alpha9 homolog; protocadherin alpha 11; protocadherin alpha 9 homolog; protocadherin alpha-11
Common Name PCDHA11
Gene Symbol PCDHA11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VNGEVTYSLMSIKPNGRHLFTLDQNNGEVRVNGTLDYEENKFYKIEVQATDK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats