missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP94303

Invitrogen™ Human NVL (aa 213-294) Control Fragment Recombinant Protein

Catalog No. RP94303
Change view
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantité
RP94303 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94303 Supplier Invitrogen™ Supplier No. RP94303

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55796. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation of epithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively spliced transcript variants have been described.

Specifications

Numéro d'enregistrement O15381
Concentration ≥5.0 mg/mL
À utiliser avec (application) Neutralization, Control
Formule PBS, 1M urea with no preservative; pH 7.4
ID du gène (Entrez) 4931
Nom Human NVL (aa 213-294) Control Fragment
Plage de pH 7.4
Méthode de purification Purified
Quantité 100 μL
Conditions de stockage -20°C, Avoid Freeze/Thaw Cycles
Statut réglementaire RUO
Alias du gène 1200009I24Rik; Nuclear valosin-containing protein-like; nuclear VCP-like; nuclear VCP-like protein; Nvl; NVL2; NVLp
Nom usuel NVL
Symbole de gène NVL
Type de produit Protein
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence LESDMKRKGKLKNKGSKRKKEDLQEVDGEIEAVLQKKAKARGLEFQISNVKFEDVGGNDMTLKEVCKMLIHMRHPEVYHHLG
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less