missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP93046

Invitrogen™ Human NOL6 (aa 1042-1146) Control Fragment Recombinant Protein

Numéro de catalogue. RP93046
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP93046 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP93046 Fournisseur Invitrogen™ Code fournisseur RP93046
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63202 (PA5-63202. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.

Spécifications

Accession Number Q9H6R4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 65083
Name Human NOL6 (aa 1042-1146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA410091; bA311H10.1; LOW QUALITY PROTEIN: nucleolar protein 6; Nol6; Nrap; nucleolar protein 6; nucleolar protein 6 (RNA-associated); nucleolar protein family 6; nucleolar protein family 6 (RNA-associated); nucleolar RNA-associated protein; UTP22
Common Name NOL6
Gene Symbol NOL6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPSSLMPVLGYDPPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKPTSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAILEDFAVLGEGLVQTVEARSERWTV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats