missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP107808

Invitrogen™ Human MRCK alpha (aa 746-806) Control Fragment Recombinant Protein

Numéro de catalogue. RP107808
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP107808 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP107808 Fournisseur Invitrogen™ Code fournisseur RP107808
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84863 (PA5-84863. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CDC42BPA (MRCKA) is a serine/threonine kinase which functions in actin cytoskeleton assembly and organization. Three independent coiled-coil domains and the N-terminal region preceding the kinase domain are responsible for intermolecular interactions leading to MRCK alpha multimerization. The transautophosphorylation process is critical for regulation of MRCK alpha catalytic activities. Binding of phorbol esters to MRCK releases its autoinhibition, allowing N-terminal dimerization and subsequent kinase activation.

Spécifications

Accession Number Q5VT25
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8476
Name Human MRCK alpha (aa 746-806) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A930014J19Rik; CDC42 binding protein kinase alpha; CDC42 binding protein kinase alpha (DMPK-like); CDC42 binidng protein kinase beta; CDC42-binding protein kinase alpha; CDC42-binding protein kinase alpha (DMPK-like); CDC42BPA; cdc42bpa {ECO:0000250; DKFZp686L1738; DKFZp686P1738; DMPK-like; DMPK-like alpha; FLJ23347; Kiaa0451; MRCK; MRCK alpha; MRCKA; myotonic dystrophy kinase-related CDC42-binding kinase alpha; myotonic dystrophy kinase-related CDC-42-binding kinase-alpha; myotonic dystrophy kinase-related CDC42-binding protein kinase alpha; myotonic dystrophy protein kinase-like alpha; mytonic dystrophy kinase-related Cdc42-binding kinase; PK428; RP5-1087E8.4; serine/threonine-protein kinase MRCK alpha; ser-thr protein kinase PK428; ser-thr protein kinase related to the myotonic dystrophy protein kinase; UniProtKB:Q5VT25}
Common Name MRCK alpha
Gene Symbol CDC42BPA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats