missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP99025

Invitrogen™ Human MPV17L2 (aa 122-206) Control Fragment Recombinant Protein

Numéro de catalogue. RP99025
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP99025 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP99025 Fournisseur Invitrogen™ Code fournisseur RP99025

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60245 (PA5-60245. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FKSG24 is a multi-pass membrane proteinPotential. It belongs to the peroxisomal membrane protein PXMP2/4 family. The exact function of FKSG24 remains unknown.

Spécifications

Numéro d'enregistrement Q567V2
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 84769
Nom Human MPV17L2 (aa 122-206) Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène FKSG24; MPV17 mitochondrial inner membrane protein like 2; MPV17 mitochondrial membrane protein-like 2; MPV17L2; mpv17-like protein 2
Nom usuel MPV17L2
Symbole de gène MPV17L2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence GCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYLKYRSPVPLTPPGCVALDTRAD
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats