missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109580

Invitrogen™ Human MPP1 (aa 1-79) Control Fragment Recombinant Protein

Numéro de catalogue. RP109580
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109580 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109580 Fournisseur Invitrogen™ Code fournisseur RP109580
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the prototype of the membrane-associated guanylate kinase (MAGUK) family proteins. MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intercellular junctions. The encoded protein is an extensively palmitoylated membrane phosphoprotein containing a PDZ domain, a Src homology 3 (SH3) motif, and a guanylate kinase domain. This gene product interacts with various cytoskeletal proteins and cell junctional proteins in different tissue and cell types, and may be involved in the regulation of cell shape, hair cell development, neural patterning of the retina, and apico-basal polarity and tumor suppression pathways in non-erythroid cells. Multiple transcript variants encoding different isoforms have been found for this gene.

Spécifications

Accession Number Q00013
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4354
Name Human MPP1 (aa 1-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 55 kDa erythrocyte membrane protein; 55 kDa; AAG12; aging-associated gene 12; C130070C03Rik; DXS552E; EMP55; erythrocyte membrane protein p55; LOC652956; membrane palmitoylated protein 1; membrane protein, palmitoylated; membrane protein, palmitoylated 1; membrane protein, palmitoylated 1, 55 kDa; migration-related gene 1; MPP1; MRG1; p55; p55 protein; palmitoylated erythrocyte membrane protein; PEMP
Common Name MPP1
Gene Symbol MPP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats