missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109698

Invitrogen™ Human MLF1 (aa 181-267) Control Fragment Recombinant Protein

Numéro de catalogue. RP109698
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109698 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109698 Fournisseur Invitrogen™ Code fournisseur RP109698
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140305 (PA5-140305. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SERBP1 may play a role in the regulation of mRNA stability. It binds to the 3'-most 134 nt of the SERPINE1/PAI1 mRNA, a region which confers cyclic nucleotide regulation of message decay.

Spécifications

Accession Number P58340
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4291
Name Human MLF1 (aa 181-267) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Hematopoietic lineage switch 7; HLS7; Mlf1; MLF-1; Myelodysplasia-myeloid leukemia factor 1; myeloid leukemia factor 1; testis tissue sperm-binding protein Li 49 e; Unknown (protein for MGC:133499)
Common Name MLF1
Gene Symbol MLF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats