missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP91766

Invitrogen™ Human MIS18A (aa 157-231) Control Fragment Recombinant Protein

Numéro de catalogue. RP91766
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP91766 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP91766 Fournisseur Invitrogen™ Code fournisseur RP91766
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53771 (PA5-53771. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C21orf45, also named as MIS18A, C21orf46 and FASP1, is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. C21orf45 has dimer (∽52 kDa) and heterodimer(∽105 kDa) forms.

Spécifications

Accession Number Q9NYP9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54069
Name Human MIS18A (aa 157-231) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610039C10Rik; 2810018N07Rik; B28; C21orf45; C21orf46; FAPP1-associated protein 1; FASP1; hMis18alpha; MIS18 kinetochore protein A; MIS18 kinetochore protein homolog A; MIS18 kinetochore protein homolog A (S. pombe); Mis18a; MIS18alpha; protein Mis18-alpha; RGD1310778
Common Name MIS18A
Gene Symbol MIS18A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats