missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP91125

Invitrogen™ Human KV1.4 (KCNA4) (aa 562-653) Control Fragment Recombinant Protein

Numéro de catalogue. RP91125
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP91125 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP91125 Fournisseur Invitrogen™ Code fournisseur RP91125

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53416 (PA5-53416. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potassium voltage-gated channel subfamily A member 4, also known as Kv1.4 or PCN2, is a protein that in humans is encoded by the KCNA4 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. It is mapped to 11p14.1. KCNA4 belongs to the A-type potassium current class, the members of which may be important in the regulation of the fast repolarizing phase of action potentials in heart and thus may influence the duration of cardiac action potential. KCNA4 also contributes to the cardiac transient outward potassium current (Ito1), the main contributing current to the repolarizing phase 1 of the cardiac action potential. This gene has been shown to interact with DLG4, KCNA2 and DLG1.

Spécifications

Numéro d'enregistrement P22459
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 3739
Nom Human KV1.4 (KCNA4) (aa 562-653) Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène cardiac potassium channel; fetal skeletal muscle potassium channel; HBK4; HK1; HPCN2; HUKII; KCHAN; Kcna4; KCNA4L; KCNA8; Kv1.4; Kv4; PCN2; potassium channel 2; potassium channel, voltage gated shaker related subfamily A, member 4; potassium voltage gated channel, shaker related subfamily, member 4; potassium voltage-gated channel subfamily A member 4; potassium voltage-gated channel, shaker-related subfamily, member 4; rapidly inactivating potassium channel; RCK4; RHK1; RK3; shaker-related potassium channel Kv1.4; type A potassium channel; voltage-gated K(+) channel HuKII; Voltage-gated potassium channel HBK4; voltage-gated potassium channel HK1; Voltage-gated potassium channel subunit Kv1.4
Nom usuel KV1.4 (KCNA4)
Symbole de gène KCNA4
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence NFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSSTSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats