missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109652

Invitrogen™ Human KIAA2012 (aa 736-818) Control Fragment Recombinant Protein

Numéro de catalogue. RP109652
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109652 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109652 Fournisseur Invitrogen™ Code fournisseur RP109652
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140350 (PA5-140350. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIAA2012 (KIAA2012) is a Protein Coding gene. Exact function is currently unknown.

Spécifications

Accession Number Q0VF49
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 100652824
Name Human KIAA2012 (aa 736-818) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Common Name KIAA2012
Gene Symbol KIAA2012
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence THHNDQDPEPRSMTLDSPRASRTEHIQTPEADIVQKVGRDYDVHHLHRGLLGYGPESPERLSAVYTSLLPREREGKAEPRLFS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats