missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP105382

Invitrogen™ Human KDELC2 (aa 442-500) Control Fragment Recombinant Protein

Numéro de catalogue. RP105382
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP105382 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP105382 Fournisseur Invitrogen™ Code fournisseur RP105382

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84709 (PA5-84709. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KDELC2 is a protein coding gene.

Spécifications

Numéro d'enregistrement Q7Z4H8
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 143888
Nom Human KDELC2 (aa 442-500) Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène KDEL (Lys-Asp-Glu-Leu) containing 2; KDEL motif containing 2; KDEL motif-containing protein 2; KDELC2; POGLUT3; Protein O-glucosyltransferase 3; Protein O-xylosyltransferase POGLUT3; UNQ1904/PRO4350
Nom usuel KDELC2
Symbole de gène KDELC2
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence KEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPEDSTAICQCHRK
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats