missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP103117

Invitrogen™ Human KBTBD5 Control Fragment Recombinant Protein

Numéro de catalogue. RP103117
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP103117 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP103117 Fournisseur Invitrogen™ Code fournisseur RP103117

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62568 (PA5-62568. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of KBTBD5 remains unknown.

Spécifications

Numéro d'enregistrement Q2TBA0
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 131377
Nom Human KBTBD5 Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène 2310024D23Rik; KBTBD5; kelch like family member 40; kelch repeat and BTB (POZ) domain containing 5; kelch repeat and BTB domain-containing protein 5; kelch-like 40; kelch-like family member 40; kelch-like protein 40; kelch-like protein 40; LOW QUALITY PROTEIN: kelch-like protein 40; Klhl40; NEM8; nemaline myopathy type 8; sarcosynapsin; SRYP; SYRP
Nom usuel KBTBD5
Symbole de gène Klhl40
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence QDLIFMISEEGAVAYDPAANECYCASLSSQVPKNHVSLVTKENQVFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWL
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats