missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109878

Invitrogen™ Human JMJD6 (aa 1-75) Control Fragment Recombinant Protein

Numéro de catalogue. RP109878
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109878 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109878 Fournisseur Invitrogen™ Code fournisseur RP109878
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Spécifications

Accession Number Q6NYC1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23210
Name Human JMJD6 (aa 1-75) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5730436I23Rik; apoptotic cell clearance receptor PtdSerR; arginine demethylase and lysine hydroxylase; bifunctional arginine demethylase and lysyl-hydroxylase JMJD6; D11Ertd195e; Histone arginine demethylase JMJD6; jmjC domain-containing protein 6; Jmjd6; jumonji domain containing 6; jumonji domain-containing protein 6; KIAA0585; Lysyl-hydroxylase JMJD6; mKIAA0585; Peptide-lysine 5-dioxygenase JMJD6; phosphatidylserine receptor; Protein PTDSR; PSR; PtdSerR; Ptdsr; PTDSR1
Common Name JMJD6
Gene Symbol JMJD6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats