missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP94576

Invitrogen™ Human INPP5B (aa 33-99) Control Fragment Recombinant Protein

Numéro de catalogue. RP94576
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP94576 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP94576 Fournisseur Invitrogen™ Code fournisseur RP94576
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83033 (PA5-83033. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B encodes the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Spécifications

Accession Number P32019
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3633
Name Human INPP5B (aa 33-99) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5 PTase; 75 kDa inositol polyphosphate-5-phosphatase; AW260155; inositol polyphosphate-5-phosphatase B; inositol polyphosphate-5-phosphatase, 75 kDa; INPP5B; INPP5P; LOW QUALITY PROTEIN: type II inositol 1,4,5-trisphosphate 5-phosphatase; MGC65156; MGC71303; OCRL2; Phosphoinositide 5-phosphatase; RP11-109P14.7; type II inositol 1,4,5-trisphosphate 5-phosphatase; type II inositol 1,4,5-trisphosphate 5-phosphatase; LOW QUALITY PROTEIN: type II inositol 1,4,5-trisphosphate 5-phosphatase; type II inositol-1
Common Name INPP5B
Gene Symbol INPP5B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats