missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109919

Invitrogen™ Human GXYLT1 Control Fragment Recombinant Protein

Numéro de catalogue. RP109919
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109919 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109919 Fournisseur Invitrogen™ Code fournisseur RP109919
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145179 (PA5-145179. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glycosyltransferase which elongates the O-linked glucose attached to EGF-like repeats in the extracellular domain of Notch proteins by catalyzing the addition of xylose.

Spécifications

Accession Number Q4G148
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 283464
Name Human GXYLT1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 242n2; Glt8d3; glucoside xylosyltransferase 1; glycosyltransferase 8 domain containing 3; glycosyltransferase 8 domain-containing protein 3; Glycosyltransferase 8 domain-containing protein 3-like protein; Gm1228; Gm87; GXYLT1; S33-D
Common Name GXYLT1
Gene Symbol GXYLT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VYEALRNCSFEDDNIRSLLKPLEPELQKTVHTYCGKIYKIFIKQLAKSVRDRFARS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats