missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP91078

Invitrogen™ Human FAM134C (aa 332-454) Control Fragment Recombinant Protein

Numéro de catalogue. RP91078
Modifier l'affichage
Click to view available options
Quantité:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantité
RP91078 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP91078 Fournisseur Invitrogen™ Code fournisseur RP91078

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53433 (PA5-53433. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RETREG3 gene ontology annotations related to this gene include positive regulation of neuron projection development.

Spécifications

Numéro d'enregistrement Q86VR2
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
ID du gène (Entrez) 162427
Nom Human FAM134C (aa 332-454) Control Fragment
Quantité 100 μL
Statut réglementaire RUO
Alias du gène 1300010M03Rik; 4933404C01Rik; AI551748; DKFZp686B1036; Fam134c; family with sequence similarity 134 member C; family with sequence similarity 134, member C; FLJ33806; protein FAM134C; Reticulophagy regulator 3; RETREG3; RGD1561189
Nom usuel FAM134C
Symbole de gène RETREG3
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Étiquette de la protéine His-ABP-tag
Séquence DFPSINMDPAGLDDEDDTSIGMPSLMYRSPPGAEEPQAPPASRDEAALPELLLGALPVGSNLTSNLASLVSQGMIQLALSGASQPGPSGAPAQRATRGFLRSPSSDLDTDAEGDDFELLDQSE
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Grade de qualité ou de pureté >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats