missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP102906

Invitrogen™ Human eIF2 beta (aa 143-216) Control Fragment Recombinant Protein

Numéro de catalogue. RP102906
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP102906 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP102906 Fournisseur Invitrogen™ Code fournisseur RP102906
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83549 (PA5-83549. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene.

Spécifications

Accession Number P20042
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8894
Name Human eIF2 beta (aa 143-216) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810026E11Rik; 38 kDa; AA408636; AA571381; AA986487; AW822225; D2Ertd303e; EIF2; EIF2B; EIF2BA; EIF2beta; eIF-2-beta; EIF2S2; Eukaryotic translation initiation factor 2 subunit 2; eukaryotic translation initiation factor 2 subunit beta; eukaryotic translation initiation factor 2, subunit 2 (beta); eukaryotic translation initiation factor 2, subunit 2 (beta, 38 kDa); eukaryotic translation initiation factor 2, subunit 2 beta; eukaryotic translation initiation factor 2, subunit 2 beta, 38 kDa; PPP1R67; protein phosphatase 1, regulatory subunit 67
Common Name eIF2 beta
Gene Symbol EIF2S2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats