missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human EEF1E1 (aa 123-174) Control Fragment Recombinant Protein

Numéro de catalogue. RP106799
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP106799 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP106799 Fournisseur Invitrogen™ Code fournisseur RP106799
Il en reste null

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66108 (PA5-66108. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a multifunctional protein that localizes both in the cytoplasm and in the nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage and plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants.

Spécifications

Accession Number O43324
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9521
Name Human EEF1E1 (aa 123-174) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110003A02Rik; AIMP3; Aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; Eef1e1; Elongation factor p18; eukaryotic translation elongation factor 1 epsilon 1; eukaryotic translation elongation factor 1 epsilon-1; Multisynthase complex auxiliary component p18; multisynthetase complex auxiliary component p18; P18; p18 component of aminoacyl-tRNA synthetase complex
Common Name EEF1E1
Gene Symbol EEF1E1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats